Atlas Antibodies Anti-CPT2 Antibody

상품 한눈에 보기

Human CPT2 단백질에 특이적인 토끼 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, RNA-seq 데이터와의 정합으로 검증된 Orthogonal Validation을 제공합니다. 글리세롤 기반 완충액에 보존 처리되어 안정성이 우수합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028214-100 Anti-CPT2 Antibody, carnitine palmitoyltransferase 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028214-25 Anti-CPT2 Antibody, carnitine palmitoyltransferase 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CPT2 Antibody

Anti-CPT2 Antibody

Target: Carnitine Palmitoyltransferase 2 (CPT2)
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal antibody against human CPT2.

Alternative Gene Names

CPT1, CPTASE

Target Information

항목	내용
Target Protein	Carnitine palmitoyltransferase 2
Target Gene	CPT2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	CKSFENGIGKELHEQLVALDKQNKHTSYISGPWFDMYLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRF
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000028607 (90%), Rat ENSRNOG00000012443 (85%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide (preservative)
MSDS	Material Safety Data Sheet