
Atlas Antibodies Anti-COX11 Antibody
상품 한눈에 보기
Human COX11 단백질을 인식하는 토끼 폴리클로날 항체로, cytochrome c oxidase assembly 연구에 적합. 높은 종간 보존성(인간-쥐 96%)을 보여 다양한 모델에서 활용 가능. PrEST 항원을 이용해 친화 정제됨. PBS/glycerol 완충액에 보존제로 sodium azide 함유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-COX11 Antibody
Target: cytochrome c oxidase assembly homolog 11 (yeast)
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학(IHC) 등 다양한 생명과학 연구용으로 사용 가능.
Product Description
Polyclonal antibody against Human COX11.
Alternative Gene Names
- COX11P
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cytochrome c oxidase assembly homolog 11 (yeast) |
| Target Gene | COX11 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | DKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPG |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000020544 (96%), Rat ENSRNOG00000052096 (95%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험 목적에 맞게 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-COX15 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COX14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COX11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COX10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COX10 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.