
Atlas Antibodies Anti-COPS8 Antibody
상품 한눈에 보기
Human COPS8 단백질을 인식하는 폴리클로날 항체로, Rabbit 호스트에서 생산됨. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제됨. Human에 대해 검증된 반응성을 가지며, 높은 종간 서열 유사성을 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-COPS8 Antibody
Target Information
- Target Protein: COP9 signalosome subunit 8
- Target Gene: COPS8
- Alternative Gene Names: COP9, CSN8, MGC1297, SGN8
Product Description
Polyclonal antibody against Human COPS8.
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
VGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAP
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000019635 | 90% |
| Mouse | ENSMUSG00000034432 | 88% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-COPS7B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COPS9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COPS8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COPS5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COPS4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.