Atlas Antibodies Anti-COPG1 Antibody

상품 한눈에 보기

Human COPG1 단백질을 인식하는 rabbit polyclonal antibody로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성과 신뢰성 있는 검증 데이터를 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA045712-100 Anti-COPG1 Antibody, coatomer protein complex, subunit gamma 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA045712-25 Anti-COPG1 Antibody, coatomer protein complex, subunit gamma 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: coatomer protein complex, subunit gamma 1 (COPG1)
Type: Polyclonal Antibody against Human COPG1

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody raised in rabbit against human COPG1.
Affinity purified using the PrEST antigen as affinity ligand.

항목	내용
Target Protein	coatomer protein complex, subunit gamma 1
Target Gene	COPG1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	MLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPL
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000010474 (99%), Mouse ENSMUSG00000030058 (99%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.