
Atlas Antibodies Anti-COL6A3 Antibody
상품 한눈에 보기
Human COL6A3 단백질을 인식하는 Rabbit Polyclonal Antibody. IHC 및 WB에 적합. PrEST 항원을 이용해 Affinity purification 수행. 높은 인간 특이성과 안정적인 반응성을 제공. 40% glycerol 기반 PBS buffer에 보존.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-COL6A3 Antibody
Target: collagen, type VI, alpha 3
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human COL6A3.
Affinity purified using the PrEST antigen as affinity ligand.
Optimal concentrations and conditions should be determined by the user.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | collagen, type VI, alpha 3 |
| Target Gene | COL6A3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (85%), Rat (23%) |
Antigen Sequence:
PRDLKIVVLMLTGEVPEQQLEEAQRVILQAKCKGYFFVVLGIGRKVNIKEVYTFASEPNDVFFKLVDKSTELNEEPLMRFGRLLPSFVSSENAFYLSPDIRKQCDWFQGDQPTKNLVKFGHKQVNVPNNVTSSPTSNPVTTTKPVT
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
| Buffer Composition | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-COL8A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COL8A2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COL6A3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COL7A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COL6A5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.