
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-COL6A3 Antibody
상품 한눈에 보기
Human COL6A3 단백질을 인식하는 Rabbit Polyclonal Antibody. IHC 및 WB에 적합. PrEST 항원을 이용해 Affinity purification 수행. 높은 인간 특이성과 안정적인 반응성을 제공. 40% glycerol 기반 PBS buffer에 보존.
- 카탈로그번호
- HPA010080-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA010080-100 Anti-COL6A3 Antibody, collagen, type VI, alpha 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010080-25 Anti-COL6A3 Antibody, collagen, type VI, alpha 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-COL6A3 Antibody
Anti-COL6A3 Antibody
Target: collagen, type VI, alpha 3
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human COL6A3.
Affinity purified using the PrEST antigen as affinity ligand.
Optimal concentrations and conditions should be determined by the user.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | collagen, type VI, alpha 3 |
| Target Gene | COL6A3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (85%), Rat (23%) |
Antigen Sequence:
PRDLKIVVLMLTGEVPEQQLEEAQRVILQAKCKGYFFVVLGIGRKVNIKEVYTFASEPNDVFFKLVDKSTELNEEPLMRFGRLLPSFVSSENAFYLSPDIRKQCDWFQGDQPTKNLVKFGHKQVNVPNNVTSSPTSNPVTTTKPVT
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
| Buffer Composition | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



