CacheBy
Atlas Antibodies Anti-COL3A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COL3A1 Antibody

상품 한눈에 보기

Human COL3A1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB 분석에 적합합니다. PrEST 항원으로 친화 정제되었으며, Orthogonal validation으로 검증되었습니다. COL3A1 단백질 발현 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007583-100 Anti-COL3A1 Antibody, collagen, type III, alpha 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007583-25 Anti-COL3A1 Antibody, collagen, type III, alpha 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COL3A1 Antibody

Anti-COL3A1 Antibody

Target: collagen, type III, alpha 1
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Orthogonal validation)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal antibody against Human COL3A1.


Alternative Gene Names

  • EDS4A

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein collagen, type III, alpha 1
Target Gene COL3A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence RGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPE
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000026043 (93%), Rat ENSRNOG00000003357 (91%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal
Orthogonal Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.