CacheBy
Atlas Antibodies Anti-COL4A6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COL4A6 Antibody

상품 한눈에 보기

Human COL4A6 단백질을 인식하는 토끼 폴리클로날 항체로, type IV collagen alpha 6 서브유닛 검출에 적합합니다. Affinity purification 방식으로 정제되었으며, 다양한 면역학적 응용에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA065393-100 Anti-COL4A6 Antibody, collagen, type IV, alpha 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065393-25 Anti-COL4A6 Antibody, collagen, type IV, alpha 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COL4A6 Antibody

Anti-COL4A6 Antibody

Target: collagen, type IV, alpha 6
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC) 등 다양한 면역학적 분석에 사용 가능

Product Description

Polyclonal antibody against Human COL4A6.
Affinity purified using the PrEST antigen as affinity ligand.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein collagen, type IV, alpha 6
Target Gene COL4A6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence EPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGV
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000031273 (53%), Rat ENSRNOG00000056772 (53%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.