CacheBy
Atlas Antibodies Anti-COL6A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COL6A1 Antibody

상품 한눈에 보기

Human COL6A1 단백질을 타깃으로 하는 고품질 폴리클로날 항체. IHC 및 ICC 등 다양한 응용에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증됨. Rabbit 유래 IgG, PrEST 항원으로 정제된 고특이성 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019142-100 Anti-COL6A1 Antibody, collagen, type VI, alpha 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019142-25 Anti-COL6A1 Antibody, collagen, type VI, alpha 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COL6A1 Antibody

Anti-COL6A1 Antibody

Target: collagen, type VI, alpha 1
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • ICC (Immunocytochemistry)

Orthogonal validation:
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human COL6A1
Open Datasheet


Target Information

항목 내용
Target Protein collagen, type VI, alpha 1
Target Gene COL6A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000001119 (89%), Rat ENSRNOG00000001249 (87%)

Antigen Sequence:
VSVGIKDVFDFIPGSDQLNVISCQGLAPSQGRPGLSLVKENYAELLEDAFLKNVTAQICIDKKCPDYTCPITFSSPADITILLD


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.