
Atlas Antibodies Anti-COG2 Antibody
상품 한눈에 보기
Human COG2 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC에 적합합니다. PrEST 항원으로 정제되었으며, 고순도 IgG 포맷으로 제공됩니다. 인간에 대한 반응성이 검증되었으며, 골지 복합체 연구에 유용합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-COG2 Antibody
Target: Component of Oligomeric Golgi Complex 2 (COG2)
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human COG2.
Alternative Gene Names
- LDLC
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Component of oligomeric Golgi complex 2 |
| Target Gene | COG2 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (75%), Rat (74%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
VPTTASSYVDSALKPLFQLQSGHKDKLKQAIIQQWLEGTLSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDD
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol in PBS (pH 7.2)
- 0.02% sodium azide (preservative)
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
