
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-COG2 Antibody
상품 한눈에 보기
Human COG2 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC에 적합합니다. PrEST 항원으로 정제되었으며, 고순도 IgG 포맷으로 제공됩니다. 인간에 대한 반응성이 검증되었으며, 골지 복합체 연구에 유용합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA076994-100 Anti-COG2 Antibody, component of oligomeric golgi complex 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA076994-25 Anti-COG2 Antibody, component of oligomeric golgi complex 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-COG2 Antibody
Anti-COG2 Antibody
Target: Component of Oligomeric Golgi Complex 2 (COG2)
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human COG2.
Alternative Gene Names
- LDLC
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Component of oligomeric Golgi complex 2 |
| Target Gene | COG2 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (75%), Rat (74%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
VPTTASSYVDSALKPLFQLQSGHKDKLKQAIIQQWLEGTLSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDD
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol in PBS (pH 7.2)
- 0.02% sodium azide (preservative)
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



