CacheBy
Atlas Antibodies Anti-CNOT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CNOT1 Antibody

상품 한눈에 보기

Human CNOT1 단백질을 인식하는 Rabbit Polyclonal 항체로, CCR4-NOT 전사 복합체 연구에 적합. Affinity purification 방식으로 고순도 확보. IHC 등 다양한 응용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046577-100 Anti-CNOT1 Antibody, CCR4-NOT transcription complex, subunit 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046577-25 Anti-CNOT1 Antibody, CCR4-NOT transcription complex, subunit 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CNOT1 Antibody

Anti-CNOT1 Antibody

Target Information

  • Target Protein: CCR4-NOT transcription complex, subunit 1
  • Target Gene: CNOT1
  • Alternative Gene Names: AD-005, CDC39, KIAA1007, NOT1, NOT1H

Product Description

Polyclonal Antibody against Human CNOT1.

  • Immunohistochemistry (IHC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TIETLMRINAHSRGNAPEGLPQLMEVVRSNYEAMIDRAHGGPNFMMHSGISQASEYDDPPGLREKAEYLLREWVNLYHSAAAGRDSTKAFSAFVG

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000012271 (100%)
  • Mouse ENSMUSG00000036550 (100%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도와 조건은 사용자가 실험 환경에 따라 결정해야 합니다.

Reference

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.