Atlas Antibodies Anti-CNOT11 Antibody

상품 한눈에 보기

Human CNOT11 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용해 Affinity 정제되었으며, PBS와 글리세롤 버퍼에 보존됩니다. Human에 대해 검증되었고 Mouse, Rat과 높은 서열 유사성을 가집니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA069823-100 Anti-CNOT11 Antibody, CCR4-NOT transcription complex, subunit 11 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA069823-25 Anti-CNOT11 Antibody, CCR4-NOT transcription complex, subunit 11 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CNOT11 Antibody

Anti-CNOT11 Antibody

Target: CCR4-NOT transcription complex, subunit 11
Supplier: Atlas Antibodies

Recommended Applications

Western Blot (WB)
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human CNOT11.

Alternative Gene Names

C2orf29, C40

Open Datasheet

Target Information

항목	내용
Target Protein	CCR4-NOT transcription complex, subunit 11
Target Gene	CNOT11
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	FRPEFIRPPPPLHICEDELAWLNPTEPDHAIQWDKSMCVKNSTGVEIKRIMAKAFKSPLSSPQQTQLLGELEKDPKLVYHIGLT
Verified Species Reactivity	Human
Interspecies Identity	Mouse (98%), Rat (98%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)