Atlas Antibodies Anti-CNN1 Antibody

상품 한눈에 보기

Human CNN1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며 RNA-seq 데이터와의 정합성을 통해 검증됨. Human, Mouse, Rat에 반응. PrEST 항원을 이용해 친화 정제됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA014263-100 Anti-CNN1 Antibody, calponin 1, basic, smooth muscle 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA014263-25 Anti-CNN1 Antibody, calponin 1, basic, smooth muscle 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: calponin 1, basic, smooth muscle (CNN1)

IHC (Orthogonal validation): Protein expression verified by comparison to RNA-seq data in tissues with high and low expression
WB (Western Blot)

항목	내용
Target Protein	calponin 1, basic, smooth muscle
Target Gene	CNN1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Rat (97%), Mouse (96%)

Antigen Sequence (Epitope):
PLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNS

항목	내용
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Safety Information	Material Safety Data Sheet