
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CNN1 Antibody
상품 한눈에 보기
Human CNN1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며 RNA-seq 데이터와의 정합성을 통해 검증됨. Human, Mouse, Rat에 반응. PrEST 항원을 이용해 친화 정제됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA014263-100 Anti-CNN1 Antibody, calponin 1, basic, smooth muscle 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014263-25 Anti-CNN1 Antibody, calponin 1, basic, smooth muscle 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CNN1 Antibody
Anti-CNN1 Antibody
Target: calponin 1, basic, smooth muscle (CNN1)
Recommended Applications
- IHC (Orthogonal validation): Protein expression verified by comparison to RNA-seq data in tissues with high and low expression
- WB (Western Blot)
Product Description
- Type: Polyclonal Antibody against Human CNN1
- Host: Rabbit
- Isotype: IgG
- Alternative Gene Names: Sm-Calp, SMCC
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | calponin 1, basic, smooth muscle |
| Target Gene | CNN1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Rat (97%), Mouse (96%) |
Antigen Sequence (Epitope):
PLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNS
Purification and Buffer
| 항목 | 내용 |
|---|---|
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Safety Information | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



