
Atlas Antibodies Anti-CNDP2 Antibody
Human CNDP2 단백질을 표적으로 하는 고품질 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 Independent validation으로 신뢰성 확보. Rabbit에서 생산되어 높은 특이성과 재현성을 제공.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CNDP2 Antibody
CNDP dipeptidase 2 (metallopeptidase M20 family)
Recommended Applications
Orthogonal Validation (IHC)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.Independent Validation (WB)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.ICC (Immunocytochemistry)
Suitable for immunocytochemistry applications.
Product Description
Polyclonal Antibody against Human CNDP2
Alternative Gene Names
CN2, CPGL, FLJ10830, HsT2298, PEPA
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | CNDP dipeptidase 2 (metallopeptidase M20 family) |
| Target Gene | CNDP2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000024644 (95%), Rat ENSRNOG00000015591 (92%) |
Antigen Sequence:
AKWVAIQSVSAWPEKRGEIRRMMEVAAADVKQLGGSVELVDIGKQKLPDGSEIPLPPILLGRLGSDPQKKTVCI
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CNEP1R1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CNEP1R1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CNDP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CNDP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CNDP2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|