Atlas Antibodies Anti-CNDP2 Antibody
Human CNDP2 단백질을 표적으로 하는 고품질 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 Independent validation으로 신뢰성 확보. Rabbit에서 생산되어 높은 특이성과 재현성을 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Atlas Antibodies · Atlas Antibodies Anti-CNDP2 Antibody
Anti-CNDP2 Antibody
CNDP dipeptidase 2 (metallopeptidase M20 family)
Recommended Applications
Orthogonal Validation (IHC)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.Independent Validation (WB)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.ICC (Immunocytochemistry)
Suitable for immunocytochemistry applications.
Product Description
Polyclonal Antibody against Human CNDP2
Alternative Gene Names
CN2, CPGL, FLJ10830, HsT2298, PEPA
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | CNDP dipeptidase 2 (metallopeptidase M20 family) |
| Target Gene | CNDP2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000024644 (95%), Rat ENSRNOG00000015591 (92%) |
Antigen Sequence:
AKWVAIQSVSAWPEKRGEIRRMMEVAAADVKQLGGSVELVDIGKQKLPDGSEIPLPPILLGRLGSDPQKKTVCI
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.