
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CMTR1 Antibody
상품 한눈에 보기
Human CMTR1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 분석에 적합합니다. Orthogonal validation으로 검증되었으며, PrEST 항원을 이용해 Affinity purification되었습니다. 다양한 종 간 높은 보존성을 보입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA029979-100 Anti-CMTR1 Antibody, cap methyltransferase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029979-25 Anti-CMTR1 Antibody, cap methyltransferase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CMTR1 Antibody
Anti-CMTR1 Antibody
Target: cap methyltransferase 1 (CMTR1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation using RNA-seq comparison)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CMTR1
Alternative Gene Names
FTSJD2, ISG95, KIAA0082, MTr1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cap methyltransferase 1 |
| Target Gene | CMTR1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GKPLVKDREAELLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFYSASSELFEPYYGEGGIDGDGDITRPENISAFRNFVL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000024019 (91%), Rat ENSRNOG00000000532 (90%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



