
Atlas Antibodies Anti-CMTR1 Antibody
Human CMTR1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 분석에 적합합니다. Orthogonal validation으로 검증되었으며, PrEST 항원을 이용해 Affinity purification되었습니다. 다양한 종 간 높은 보존성을 보입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CMTR1 Antibody
Target: cap methyltransferase 1 (CMTR1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation using RNA-seq comparison)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CMTR1
Alternative Gene Names
FTSJD2, ISG95, KIAA0082, MTr1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cap methyltransferase 1 |
| Target Gene | CMTR1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GKPLVKDREAELLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFYSASSELFEPYYGEGGIDGDGDITRPENISAFRNFVL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000024019 (91%), Rat ENSRNOG00000000532 (90%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CMTR2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CMTR1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CMTR1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CMTM8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CMTM8 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|