
Atlas Antibodies Anti-CLPTM1L Antibody
상품 한눈에 보기
인간 CLPTM1L 단백질을 인식하는 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, RNA-seq 데이터 기반의 정교한 직교 검증 수행. 토끼 유래 IgG로, PrEST 항원을 이용해 친화 정제됨. 인간에 특이적으로 반응하며 높은 종간 상동성을 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CLPTM1L Antibody
Target: CLPTM1-like
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation using RNA-seq comparison in high and low expression tissues)
- ICC
Product Description
Polyclonal antibody against human CLPTM1L.
Alternative Gene Names
CRR9, FLJ14400
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | CLPTM1-like |
| Target Gene | CLPTM1L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LNVEDFDVESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHDGKQVHLVSPLTTYMVPKPEEINLLTGESDTQQIEAEKKPTSALDEPVSHWRPRLALNVMADNFVFDGSSLPADVHRYMKMIQLGKTVHYL |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000016923 (93%) Mouse ENSMUSG00000021610 (91%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CLRN3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CLSPN Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CLPTM1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CLRN2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CLPX Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.