CacheBy
Atlas Antibodies Anti-CLPX Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CLPX Antibody

상품 한눈에 보기

인간 CLPX 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 및 ICC에 적합하며 PrEST 항원을 이용해 친화 정제됨. 40% 글리세롤 기반 완충액에 보존제가 포함되어 안정적 보관 가능. 다양한 종 간 교차 반응성 확인됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048199-100 Anti-CLPX Antibody, caseinolytic mitochondrial matrix peptidase chaperone subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048199-25 Anti-CLPX Antibody, caseinolytic mitochondrial matrix peptidase chaperone subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CLPX Antibody

Anti-CLPX Antibody

Target: Caseinolytic mitochondrial matrix peptidase chaperone subunit (CLPX)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human CLPX.

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Caseinolytic mitochondrial matrix peptidase chaperone subunit
Target Gene CLPX
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GRLGTFETQILQRAPLRSFTETPAYFASKDGISKDGSGDGNKKSASEGSSKKSGSGNSGKGGNQLRCPKCGDLCTHVETFVSSTRFVKCEKCHH
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000030225 (90%), Mouse ENSMUSG00000015357 (87%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.