Thermo Fisher Scientific BCAR3 Polyclonal Antibody
BCAR3 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot 및 IHC(P)에서 검증됨. 인간, 마우스, 랫트 반응성. 합성 펩타이드 면역원 기반, 항원 친화 크로마토그래피로 정제. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific BCAR3 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Not Applicable |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human BCAR3 (791–825aa KGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745974 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers can progress to become anti-estrogen resistant.
The BCAR3 gene (Breast Cancer Anti-Estrogen Resistance 3) encodes a component of intracellular signal transduction that induces estrogen-independent proliferation in human breast cancer cells.
The protein contains a putative SH2 (src homology 2) domain, characteristic of cellular tyrosine kinase signaling molecules, and shows partial homology to the cell division cycle protein CDC48.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.