Thermo Fisher Scientific BCAR3 Polyclonal Antibody
BCAR3 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot 및 IHC(P)에서 검증됨. 인간, 마우스, 랫트 반응성. 합성 펩타이드 면역원 기반, 항원 친화 크로마토그래피로 정제. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Not Applicable |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human BCAR3 (791–825aa KGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2745974 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers can progress to become anti-estrogen resistant.
The BCAR3 gene (Breast Cancer Anti-Estrogen Resistance 3) encodes a component of intracellular signal transduction that induces estrogen-independent proliferation in human breast cancer cells.
The protein contains a putative SH2 (src homology 2) domain, characteristic of cellular tyrosine kinase signaling molecules, and shows partial homology to the cell division cycle protein CDC48.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Butyrylcholinesterase Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Bcl-xL Polyclonal Antibody, DyLight 488
661,800원
Thermo Fisher Scientific
Thermo Fisher Scientific BCAR3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific BCAT1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific BCL-XL Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|