CacheBy
Atlas Antibodies Anti-PSMG2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMG2 Antibody

상품 한눈에 보기

Human PSMG2 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 IHC에 적합. 재조합 단백질 기반 검증 완료. 고순도 친화 정제 항체로 높은 특이성과 재현성 제공. Human에 반응하며, Mouse 및 Rat과 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA041517-100 Anti-PSMG2 Antibody, proteasome (prosome, macropain) assembly chaperone 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041517-25 Anti-PSMG2 Antibody, proteasome (prosome, macropain) assembly chaperone 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMG2 Antibody

Anti-PSMG2 Antibody

Target Protein: proteasome (prosome, macropain) assembly chaperone 2
Product Type: Polyclonal Antibody against Human PSMG2


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody produced in rabbit against human PSMG2.
Validated for recombinant expression and enhanced validation.


Alternative Gene Names

CLAST3, HCCA3, HsT1707, MDS003, MGC15092, PAC2, TNFSF5IP1

Open Datasheet (PDF)


Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
GFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNPYATTEGNSTELSINAEVYSLPSRKLVALQ


Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000024537 88%
Rat ENSRNOG00000017729 87%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.