
Atlas Antibodies Anti-PSMG2 Antibody
Human PSMG2 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 IHC에 적합. 재조합 단백질 기반 검증 완료. 고순도 친화 정제 항체로 높은 특이성과 재현성 제공. Human에 반응하며, Mouse 및 Rat과 높은 서열 유사성 보유.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PSMG2 Antibody
Target Protein: proteasome (prosome, macropain) assembly chaperone 2
Product Type: Polyclonal Antibody against Human PSMG2
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Recombinant expression validation using target protein overexpression
Product Description
Polyclonal antibody produced in rabbit against human PSMG2.
Validated for recombinant expression and enhanced validation.
Alternative Gene Names
CLAST3, HCCA3, HsT1707, MDS003, MGC15092, PAC2, TNFSF5IP1
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
GFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNPYATTEGNSTELSINAEVYSLPSRKLVALQ
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000024537 | 88% |
| Rat | ENSRNOG00000017729 | 87% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PSMG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PSMG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PSMG2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PSMF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PSMF1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|