
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PSMG2 Antibody
상품 한눈에 보기
Human PSMG2 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 IHC에 적합. 재조합 단백질 기반 검증 완료. 고순도 친화 정제 항체로 높은 특이성과 재현성 제공. Human에 반응하며, Mouse 및 Rat과 높은 서열 유사성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA041517-100 Anti-PSMG2 Antibody, proteasome (prosome, macropain) assembly chaperone 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041517-25 Anti-PSMG2 Antibody, proteasome (prosome, macropain) assembly chaperone 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PSMG2 Antibody
Anti-PSMG2 Antibody
Target Protein: proteasome (prosome, macropain) assembly chaperone 2
Product Type: Polyclonal Antibody against Human PSMG2
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Recombinant expression validation using target protein overexpression
Product Description
Polyclonal antibody produced in rabbit against human PSMG2.
Validated for recombinant expression and enhanced validation.
Alternative Gene Names
CLAST3, HCCA3, HsT1707, MDS003, MGC15092, PAC2, TNFSF5IP1
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
GFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNPYATTEGNSTELSINAEVYSLPSRKLVALQ
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000024537 | 88% |
| Rat | ENSRNOG00000017729 | 87% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



