
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PSMD7 Antibody
상품 한눈에 보기
Human PSMD7 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 독립 항체 검증을 통해 높은 신뢰도의 단백질 발현 확인이 가능합니다. PrEST 항원을 사용한 친화 정제 방식으로 제조되었습니다.
- 카탈로그번호
- HPA049824-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA049824-100 Anti-PSMD7 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049824-25 Anti-PSMD7 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PSMD7 Antibody
Anti-PSMD7 Antibody
Target: proteasome (prosome, macropain) 26S subunit, non-ATPase, 7
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
- WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human PSMD7
Alternative Gene Names
MOV34, P40, Rpn8, S12
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | proteasome (prosome, macropain) 26S subunit, non-ATPase, 7 |
| Target Gene | PSMD7 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLE |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000039067 (100%), Rat ENSRNOG00000014097 (98%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



