CacheBy
Atlas Antibodies Anti-PSMD7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2
Atlas Antibodies

Atlas Antibodies Anti-PSMD7 Antibody

상품 한눈에 보기

Human PSMD7 단백질을 표적으로 하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 독립적 항체 비교를 통한 검증으로 높은 신뢰성을 제공합니다. Affinity purification 방식으로 정제되어 안정적이며 보존 용액에 나트륨 아지드가 포함되어 있습니다.

카탈로그번호
HPA056069-xxx (2개 옵션)
브랜드
Atlas Antibodies
카테고리
Polyclonal Antibodies
판매단위
100ul, 25ul
#Antibodies#Atlas Antibodies

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056069-100 Anti-PSMD7 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056069-25 Anti-PSMD7 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PSMD7 Antibody

Anti-PSMD7 Antibody

Target: proteasome (prosome, macropain) 26S subunit, non-ATPase, 7
Supplier: Atlas Antibodies

  • IHC (Independent validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Independent validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against Human PSMD7

Alternative Gene Names

MOV34, P40, Rpn8, S12

Target Information

항목 내용
Target Protein proteasome (prosome, macropain) 26S subunit, non-ATPase, 7
Target Gene PSMD7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (100%), Rat (98%)

Antigen Sequence: 

TFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLE

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)

제품 이미지

Enhanced Validation
IHC Independent
WB Independent
ICC

Atlas Antibodies 상품 둘러보기

전체보기
Atlas AntibodiesAtlas Antibodies Anti-PSMD9 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-PSMD7 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-PSMD13 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-PSMD3 Antibody528,000원VAT별도

문의

0개
로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.