
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PSMD13 Antibody
상품 한눈에 보기
인간 PSMD13 단백질을 인식하는 폴리클로날 항체로, WB 및 IHC 실험에 적합합니다. 토끼에서 생산되었으며 PrEST 항원으로 친화 정제되었습니다. 높은 종간 서열 일치도를 가진 신뢰성 높은 단백질 검증용 항체입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA038691-100 Anti-PSMD13 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 13 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038691-25 Anti-PSMD13 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 13 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PSMD13 Antibody
Anti-PSMD13 Antibody
proteasome (prosome, macropain) 26S subunit, non-ATPase, 13
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Independent validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human PSMD13
Alternative Gene Names
- p40.5
- Rpn9
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | proteasome (prosome, macropain) 26S subunit, non-ATPase, 13 |
| Target Gene | PSMD13 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAFNSGNVERFQTLKTAWGQQPDLAANEAQLLR |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000014109 (96%), Mouse ENSMUSG00000025487 (95%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



