Atlas Antibodies Anti-PSMD13 Antibody

상품 한눈에 보기

인간 PSMD13 단백질을 인식하는 폴리클로날 항체로, WB 및 IHC 실험에 적합합니다. 토끼에서 생산되었으며 PrEST 항원으로 친화 정제되었습니다. 높은 종간 서열 일치도를 가진 신뢰성 높은 단백질 검증용 항체입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038691-100 Anti-PSMD13 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 13 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038691-25 Anti-PSMD13 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 13 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

proteasome (prosome, macropain) 26S subunit, non-ATPase, 13

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal Antibody against Human PSMD13

항목	내용
Target Protein	proteasome (prosome, macropain) 26S subunit, non-ATPase, 13
Target Gene	PSMD13
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	ERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAFNSGNVERFQTLKTAWGQQPDLAANEAQLLR
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000014109 (96%), Mouse ENSMUSG00000025487 (95%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand