CacheBy
Atlas Antibodies Anti-PSMD13 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMD13 Antibody

상품 한눈에 보기

인간 PSMD13 단백질을 인식하는 폴리클로날 항체로, WB 및 IHC 실험에 적합합니다. 토끼에서 생산되었으며 PrEST 항원으로 친화 정제되었습니다. 높은 종간 서열 일치도를 가진 신뢰성 높은 단백질 검증용 항체입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA038691-100 Anti-PSMD13 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 13 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038691-25 Anti-PSMD13 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 13 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMD13 Antibody

Anti-PSMD13 Antibody

proteasome (prosome, macropain) 26S subunit, non-ATPase, 13


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Independent validation)

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human PSMD13


Alternative Gene Names

  • p40.5
  • Rpn9

Open Datasheet


Target Information

항목 내용
Target Protein proteasome (prosome, macropain) 26S subunit, non-ATPase, 13
Target Gene PSMD13
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence ERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAFNSGNVERFQTLKTAWGQQPDLAANEAQLLR
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000014109 (96%), Mouse ENSMUSG00000025487 (95%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.