Atlas Antibodies Anti-PSMD9 Antibody

상품 한눈에 보기

Human PSMD9 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 사용 가능. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 검증 완료, 높은 종간 서열 유사성 보유.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA040512-100 Anti-PSMD9 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA040512-25 Anti-PSMD9 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: proteasome (prosome, macropain) 26S subunit, non-ATPase, 9
Supplier: Atlas Antibodies

Validation Note:
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal Antibody against Human PSMD9

p27, Rpn4

항목	내용
Target Protein	proteasome (prosome, macropain) 26S subunit, non-ATPase, 9
Target Gene	PSMD9
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	SDEEARQSGGSSQAGAVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVR
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000001339 (83%), Mouse ENSMUSG00000029440 (78%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.