
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PSMD9 Antibody
상품 한눈에 보기
Human PSMD9 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 사용 가능. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 검증 완료, 높은 종간 서열 유사성 보유.
- 카탈로그번호
- HPA040512-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA040512-100 Anti-PSMD9 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040512-25 Anti-PSMD9 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PSMD9 Antibody
Anti-PSMD9 Antibody
Target: proteasome (prosome, macropain) 26S subunit, non-ATPase, 9
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent antibody validation)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Validation Note:
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human PSMD9
Alternative Gene Names
p27, Rpn4
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 |
| Target Gene | PSMD9 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SDEEARQSGGSSQAGAVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVR |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000001339 (83%), Mouse ENSMUSG00000029440 (78%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



