CacheBy
Atlas Antibodies Anti-PSMC5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMC5 Antibody

상품 한눈에 보기

인간 PSMC5 단백질을 표적으로 하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Proteasome 26S subunit ATPase 5 단백질 검출에 사용되며, 고순도 Affinity 정제 방식으로 제조되었습니다.

카탈로그번호
HPA017871-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA017871-100 Anti-PSMC5 Antibody, proteasome (prosome, macropain) 26S subunit, ATPase, 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017871-25 Anti-PSMC5 Antibody, proteasome (prosome, macropain) 26S subunit, ATPase, 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMC5 Antibody

Anti-PSMC5 Antibody

Target Protein: proteasome (prosome, macropain) 26S subunit, ATPase, 5
Supplier: Atlas Antibodies


  • IHC (Independent validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human PSMC5


Alternative Gene Names

p45, p45/SUG, S8, SUG-1, SUG1, TBP10, TRIP1

Open Datasheet


Specifications

항목 내용
Target Protein proteasome (prosome, macropain) 26S subunit, ATPase, 5
Target Gene PSMC5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000020708 (100%), Rat ENSRNOG00000010038 (100%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.