CacheBy
Atlas Antibodies Anti-PSMD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMD1 Antibody

상품 한눈에 보기

Human PSMD1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 검증으로 높은 신뢰도의 단백질 발현 분석 제공. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 보장.

카탈로그번호
HPA036737-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036737-100 Anti-PSMD1 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036737-25 Anti-PSMD1 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMD1 Antibody

Anti-PSMD1 Antibody

Target: proteasome (prosome, macropain) 26S subunit, non-ATPase, 1
Supplier: Atlas Antibodies


  • IHC (Independent antibody validation)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human PSMD1.


Alternative Gene Names

P112, Rpn2, S1


Target Information

항목 내용
Target Protein proteasome (prosome, macropain) 26S subunit, non-ATPase, 1
Target Gene PSMD1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALE
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000017730 (100%), Mouse ENSMUSG00000026229 (100%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Independent Validation
Tooltip Independent Validation
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.