CacheBy
Atlas Antibodies Anti-PSMD10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMD10 Antibody

상품 한눈에 보기

Human PSMD10 단백질을 타깃으로 하는 고품질 Rabbit Polyclonal 항체. IHC, WB, ICC 등 다양한 응용에 적합. siRNA knockdown으로 유전적 검증 완료. PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA002920-100 Anti-PSMD10 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002920-25 Anti-PSMD10 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMD10 Antibody

Anti-PSMD10 Antibody

Target: proteasome (prosome, macropain) 26S subunit, non-ATPase, 10
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Genetic validation by siRNA knockdown
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PSMD10 protein.


Alternative Gene Names

  • p28

Open Datasheet


Target Information

항목 내용
Target Protein proteasome (prosome, macropain) 26S subunit, non-ATPase, 10
Target Gene PSMD10
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000031429 (94%), Rat ENSRNOG00000057649 (85%)

Antigen Sequence:
EGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPL


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Genetic Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.