CacheBy
Atlas Antibodies Anti-PSMD12 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMD12 Antibody

상품 한눈에 보기

Human PSMD12 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC, WB, ICC 등 다양한 응용에 적합하며, 고순도 Affinity 정제 방식으로 제조되었습니다. PSMD12 관련 연구 및 단백질 분석에 활용 가능합니다.

카탈로그번호
HPA023119-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023119-100 Anti-PSMD12 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 12 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023119-25 Anti-PSMD12 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 12 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMD12 Antibody

Anti-PSMD12 Antibody

Target Information

  • Target Protein: Proteasome (prosome, macropain) 26S subunit, non-ATPase, 12
  • Target Gene: PSMD12
  • Alternative Gene Names: p55, Rpn5

Product Description

Polyclonal antibody against human PSMD12.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

WQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLEEIPKYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKRWKDLKNRVVEH

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000003117 (95%)
  • Mouse ENSMUSG00000020720 (94%)

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Applications IHC, WB, ICC
Recommended Use Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet
Material Safety Data Sheet


제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.