
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PSMD12 Antibody
상품 한눈에 보기
Human PSMD12 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC, WB, ICC 등 다양한 응용에 적합하며, 고순도 Affinity 정제 방식으로 제조되었습니다. PSMD12 관련 연구 및 단백질 분석에 활용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA023119-100 Anti-PSMD12 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 12 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023119-25 Anti-PSMD12 Antibody, proteasome (prosome, macropain) 26S subunit, non-ATPase, 12 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PSMD12 Antibody
Anti-PSMD12 Antibody
Target Information
- Target Protein: Proteasome (prosome, macropain) 26S subunit, non-ATPase, 12
- Target Gene: PSMD12
- Alternative Gene Names: p55, Rpn5
Product Description
Polyclonal antibody against human PSMD12.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
WQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLEEIPKYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKRWKDLKNRVVEH
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000003117 (95%)
- Mouse ENSMUSG00000020720 (94%)
Technical Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Applications | IHC, WB, ICC |
| Recommended Use Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Open Datasheet
Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



