CacheBy
Atlas Antibodies Anti-PSMB9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMB9 Antibody

상품 한눈에 보기

인간 PSMB9 단백질을 표적으로 하는 폴리클로날 토끼 IgG 항체. 프로테아좀 서브유닛 베타 9 검출용으로 설계됨. 고순도 PrEST 항원 기반 친화 정제. 인간 반응성 검증 완료. 다양한 응용 조건에 최적화 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA042818-100 Anti-PSMB9 Antibody, proteasome subunit beta 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042818-25 Anti-PSMB9 Antibody, proteasome subunit beta 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMB9 Antibody

Anti-PSMB9 Antibody

Target Information

  • Target Protein: Proteasome subunit beta 9
  • Target Gene: PSMB9
  • Alternative Gene Names: beta1i, LMP2, PSMB6i, RING12

Product Description

Polyclonal antibody against human PSMB9, generated in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
GIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGG

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Rat ENSRNOG00000000459 (91%)
  • Mouse ENSMUSG00000096727 (88%)

ICC (Immunocytochemistry)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Verified Reactivity Human
Applications ICC

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference Documents

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.