
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PSMB9 Antibody
상품 한눈에 보기
인간 PSMB9 단백질을 표적으로 하는 폴리클로날 토끼 IgG 항체. 프로테아좀 서브유닛 베타 9 검출용으로 설계됨. 고순도 PrEST 항원 기반 친화 정제. 인간 반응성 검증 완료. 다양한 응용 조건에 최적화 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA042818-100 Anti-PSMB9 Antibody, proteasome subunit beta 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042818-25 Anti-PSMB9 Antibody, proteasome subunit beta 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PSMB9 Antibody
Anti-PSMB9 Antibody
Target Information
- Target Protein: Proteasome subunit beta 9
- Target Gene: PSMB9
- Alternative Gene Names: beta1i, LMP2, PSMB6i, RING12
Product Description
Polyclonal antibody against human PSMB9, generated in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:GIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGG
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Rat ENSRNOG00000000459 (91%)
- Mouse ENSMUSG00000096727 (88%)
Recommended Applications
ICC (Immunocytochemistry)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Verified Reactivity | Human |
| Applications | ICC |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference Documents
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



