CacheBy
Atlas Antibodies Anti-PSMB7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMB7 Antibody

상품 한눈에 보기

Human PSMB7 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 다양한 연구 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. PBS/glycerol buffer에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA052408-100 Anti-PSMB7 Antibody, proteasome (prosome, macropain) subunit, beta type, 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052408-25 Anti-PSMB7 Antibody, proteasome (prosome, macropain) subunit, beta type, 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMB7 Antibody

Anti-PSMB7 Antibody

Target: proteasome (prosome, macropain) subunit, beta type, 7
Supplier: Atlas Antibodies


면역조직화학 (IHC) 등 다양한 연구 응용에 적합


Product Description

Polyclonal antibody against Human PSMB7


Alternative Gene Names

Z


Target Information

  • Target Protein: proteasome (prosome, macropain) subunit, beta type, 7
  • Target Gene: PSMB7
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEA

Verified Species Reactivity

Human


Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000011732 100%
Mouse ENSMUSG00000026750 100%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.