CacheBy
Atlas Antibodies Anti-PSMB7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMB7 Antibody

상품 한눈에 보기

Human PSMB7 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 다양한 연구 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. PBS/glycerol buffer에 보존제로 sodium azide 포함.

카탈로그번호
HPA052408-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052408-100 Anti-PSMB7 Antibody, proteasome (prosome, macropain) subunit, beta type, 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052408-25 Anti-PSMB7 Antibody, proteasome (prosome, macropain) subunit, beta type, 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMB7 Antibody

Anti-PSMB7 Antibody

Target: proteasome (prosome, macropain) subunit, beta type, 7
Supplier: Atlas Antibodies


면역조직화학 (IHC) 등 다양한 연구 응용에 적합


Product Description

Polyclonal antibody against Human PSMB7


Alternative Gene Names

Z


Target Information

  • Target Protein: proteasome (prosome, macropain) subunit, beta type, 7
  • Target Gene: PSMB7
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEA

Verified Species Reactivity

Human


Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000011732 100%
Mouse ENSMUSG00000026750 100%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.