CacheBy
Atlas Antibodies Anti-PSMB6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMB6 Antibody

상품 한눈에 보기

Human PSMB6 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB 실험에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 보입니다. 40% glycerol 기반 완충액에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA023312-100 Anti-PSMB6 Antibody, proteasome (prosome, macropain) subunit, beta type, 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023312-25 Anti-PSMB6 Antibody, proteasome (prosome, macropain) subunit, beta type, 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMB6 Antibody

Anti-PSMB6 Antibody

Target: proteasome (prosome, macropain) subunit, beta type, 6
Type: Polyclonal Antibody against Human PSMB6


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Rabbit polyclonal antibody targeting the human PSMB6 protein, a subunit of the proteasome complex involved in protein degradation.


Alternative Gene Names

  • DELTA
  • Y

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein proteasome (prosome, macropain) subunit, beta type, 6
Target Gene PSMB6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MAATLLAARGAGPAPAWGPEAFTPDWESREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLT
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000019551 (86%), Mouse ENSMUSG00000018286 (84%)

Antibody Information

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.