CacheBy
Atlas Antibodies Anti-PSMB7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMB7 Antibody

상품 한눈에 보기

인간 PSMB7 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Affinity purification으로 고순도 확보. IHC 등 다양한 응용에 적합하며, PBS/glycerol buffer에 보존되어 안정적입니다.

카탈로그번호
HPA054902-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054902-100 Anti-PSMB7 Antibody, proteasome subunit beta 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054902-25 Anti-PSMB7 Antibody, proteasome subunit beta 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMB7 Antibody

Anti-PSMB7 Antibody

Target Information

  • Target Protein: Proteasome (prosome, macropain) subunit, beta type, 7
  • Target Gene: PSMB7
  • Alternative Gene Names: Z

Product Description

Polyclonal Antibody against Human PSMB7

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEA

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000011732 (100%)
  • Mouse ENSMUSG00000026750 (100%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

IHC (Immunohistochemistry)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.