Atlas Antibodies Anti-PSMB1 Antibody

상품 한눈에 보기

Human PSMB1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 비교를 통한 검증 완료. 높은 종간 보존성(인간-마우스 98%). PrEST 항원으로 친화 정제됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA029637-100 Anti-PSMB1 Antibody, proteasome (prosome, macropain) subunit, beta type, 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA029637-25 Anti-PSMB1 Antibody, proteasome (prosome, macropain) subunit, beta type, 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: proteasome (prosome, macropain) subunit, beta type, 1
Supplier: Atlas Antibodies

IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Independent Validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC: Immunocytochemistry application supported.

Polyclonal Antibody against Human PSMB1.

HC5, PMSB1

항목	내용
Target Protein	proteasome (prosome, macropain) subunit, beta type, 1
Target Gene	PSMB1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000014769 (98%) Rat ENSRNOG00000001488 (98%)

Antigen Sequence:
YQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand