CacheBy
Atlas Antibodies Anti-PSMB10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMB10 Antibody

상품 한눈에 보기

Human PSMB10 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, RNA-seq 데이터와의 직교 검증을 통해 단백질 발현 확인. PrEST 항원으로 친화 정제된 고품질 항체로 높은 특이성과 재현성을 제공.

카탈로그번호
HPA030224-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030224-100 Anti-PSMB10 Antibody, proteasome (prosome, macropain) subunit, beta type, 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030224-25 Anti-PSMB10 Antibody, proteasome (prosome, macropain) subunit, beta type, 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMB10 Antibody

Anti-PSMB10 Antibody

Target: proteasome (prosome, macropain) subunit, beta type, 10


  • IHC (Immunohistochemistry)
  • ICC (Immunocytochemistry)
  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human PSMB10

Alternative Gene Names: beta2i, LMP10, MECL1, MGC1665

Open Datasheet


Target Information

항목 내용
Target Protein proteasome (prosome, macropain) subunit, beta type, 10
Target Gene PSMB10
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVT
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000019494 (92%), Mouse ENSMUSG00000031897 (89%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.