CacheBy
Atlas Antibodies Anti-PRSS48 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRSS48 Antibody

상품 한눈에 보기

Human PRSS48 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PRSS48 단백질의 PrEST 항원을 이용해 친화 정제됨. 40% 글리세롤 및 PBS 완충액에 보존되어 안정적. 사람에 대한 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA053801-100 Anti-PRSS48 Antibody, protease, serine, 48 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053801-25 Anti-PRSS48 Antibody, protease, serine, 48 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRSS48 Antibody

Anti-PRSS48 Antibody

Target Protein: protease, serine, 48
Alternative Gene Name: ESSPL


Product Description

Polyclonal antibody against human PRSS48, generated in rabbit and affinity purified using the PrEST antigen as affinity ligand.

  • Immunohistochemistry (IHC)

Target Information

항목 내용
Target Protein protease, serine, 48
Target Gene PRSS48
Alternative Gene Name ESSPL
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000024208 (36%), Mouse ENSMUSG00000032493 (25%)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
GVYTNVIYYQKWINATISRANNLDFSDFLFPIVLLSLALLRPSCAFGPNTIHRVGTVAEAVACIQGWEENAWRFSPR


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.