CacheBy
Atlas Antibodies Anti-PRSS38 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRSS38 Antibody

상품 한눈에 보기

인체 PRSS38 단백질에 특이적인 토끼 폴리클로날 항체. IHC 및 WB(재조합 발현) 검증 완료. PrEST 항원을 이용한 친화 정제 방식. 인간에서 반응성 확인, 설치류와의 상동성 정보 제공. 글리세롤 기반 완충액에 보존제 포함.

카탈로그번호
HPA055809-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055809-100 Anti-PRSS38 Antibody, protease, serine, 38 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055809-25 Anti-PRSS38 Antibody, protease, serine, 38 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRSS38 Antibody

Anti-PRSS38 Antibody

Target: protease, serine, 38 (PRSS38)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression Validation)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal Antibody against Human PRSS38.


Alternative Gene Names

  • MPN2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein protease, serine, 38
Target Gene PRSS38
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence NLTSANCWATGWGLVSKQGETSDELQEMQLPLILEPWCHLLYGHMSYIMPDMLCAGDILNAKTVCEGDS
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000022548 (64%)
Mouse ENSMUSG00000049291 (59%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.