CacheBy
Atlas Antibodies Anti-PRSS42 Antibody
원본

Atlas Antibodies Anti-PRSS42 Antibody

상품 한눈에 보기

Human PRSS42 단백질에 대한 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식의 항체입니다. IHC 및 Western Blot에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응하며 Rat 및 Mouse와도 부분적 교차 반응성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA046925-100 Anti-PRSS42 Antibody, protease, serine, 42 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046925-25 Anti-PRSS42 Antibody, protease, serine, 42 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRSS42 Antibody

Anti-PRSS42 Antibody

Target Protein: protease, serine, 42
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot)

Product Description

Polyclonal antibody against Human PRSS42.


Alternative Gene Names

  • TESSP2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein protease, serine, 42
Target Gene PRSS42
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence CISSRFHYSVKMGDRSVYNENTSVVVSVQRAFVHPKFSTVTTIRNDLALL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000031971 66%
Mouse ENSMUSG00000044664 60%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험에 따라 결정해야 합니다.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.