CacheBy
Atlas Antibodies Anti-PRSS53 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRSS53 Antibody

상품 한눈에 보기

Human PRSS53 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity Purified 제품입니다. IHC 등 다양한 응용에 적합하며, 높은 종 특이성과 재현성을 제공합니다. PBS 및 글리세롤 버퍼에 보존되어 안정성이 우수합니다.

카탈로그번호
HPA034955-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034955-100 Anti-PRSS53 Antibody, protease, serine, 53 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034955-25 Anti-PRSS53 Antibody, protease, serine, 53 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRSS53 Antibody

Anti-PRSS53 Antibody

Target: protease, serine, 53 (PRSS53)
Type: Polyclonal Antibody against Human PRSS53


  • Immunohistochemistry (IHC)

Product Description

Polyclonal Antibody against Human PRSS53 protein.


Alternative Gene Names

  • POL3S

Open Datasheet (PDF)


Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Sequence:

PTTHTPLCLPQPAHRFPFGASCWATGWDQDTSDAPGTLRNLRLRLISRPTCNCIYNQLHQRHLSNPARPGMLCG

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000044139 82%
Rat ENSRNOG00000026040 81%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.