
Atlas Antibodies Anti-PRR26 Antibody
상품 한눈에 보기
Human PRR26 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, IHC 등 다양한 연구 응용에 적합. PrEST 항원으로 친화 정제되었으며, 인체 반응성이 검증됨. 안정한 PBS/glycerol buffer에 보존제로 sodium azide 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PRR26 Antibody
Target Information
- Target Protein: Proline Rich 26
- Target Gene: PRR26
- Alternative Gene Names: C10orf108, FLJ38681
Product Description
Polyclonal antibody against Human PRR26.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:SPTPPKLSPGQLSPHSVNVHWGPQGHLHLPRSGTTVLHAYLQTLSSPAS
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Mouse (ENSMUSG00000024818): 34%
- Rat (ENSRNOG00000010588): 33%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Material Safety Data Sheet
Open Datasheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Recommended Applications
면역조직화학(IHC) 등 일반적인 항체 응용에 적합.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PRR3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRR25 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRR26 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRR23A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRR22 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.