
Atlas Antibodies Anti-PRR13 Antibody
상품 한눈에 보기
인간 PRR13 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 40% 글리세롤 기반 PBS 버퍼에 보존되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PRR13 Antibody
Target Protein: Proline Rich 13 (PRR13)
Product Type: Polyclonal Antibody against Human PRR13
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
This polyclonal antibody is produced in rabbit and targets the human PRR13 protein. It is affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
- DKFZP564J157
- FLJ23818
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
PYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKK
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000023048 | 73% |
| Rat | ENSRNOG00000042094 | 70% |
Antibody Specifications
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PRR13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRR15 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRR13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRR14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRR14 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.