CacheBy
Atlas Antibodies Anti-PRR13 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRR13 Antibody

상품 한눈에 보기

인간 PRR13 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 40% 글리세롤 기반 PBS 버퍼에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA046219-100 Anti-PRR13 Antibody, proline rich 13 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046219-25 Anti-PRR13 Antibody, proline rich 13 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRR13 Antibody

Anti-PRR13 Antibody

Target Protein: Proline Rich 13 (PRR13)
Product Type: Polyclonal Antibody against Human PRR13


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody is produced in rabbit and targets the human PRR13 protein. It is affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

  • DKFZP564J157
  • FLJ23818

Open Datasheet (PDF)


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    PYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKK

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000023048 73%
Rat ENSRNOG00000042094 70%

Antibody Specifications

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.