
Atlas Antibodies Anti-PRMT5 Antibody
상품 한눈에 보기
Human PRMT5 단백질에 대한 고특이적 폴리클로날 항체로 IHC, WB, ICC에 적합. siRNA knockdown을 통한 유전적 검증 완료. Rabbit 유래 IgG, PrEST 항원으로 친화 정제. Human, Mouse, Rat 반응성 검증.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PRMT5 Antibody
Target: Protein Arginine Methyltransferase 5 (PRMT5)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) — Genetic validation by siRNA knockdown
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human PRMT5
Alternative Gene Names
HRMT1L5, SKB1, SKB1Hs
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Protein Arginine Methyltransferase 5 |
| Target Gene | PRMT5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000023110 (97%), Rat ENSRNOG00000012046 (97%) |
Antigen Sequence:
LLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHF
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PRMT9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRMT9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRMT5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRMT5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRMT3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.