
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PRKCQ Antibody
상품 한눈에 보기
인간 PRKCQ 단백질을 인식하는 토끼 유래 폴리클로날 항체입니다. PRKCQ (protein kinase C, theta) 검출용으로 개발되었으며, 고순도의 Affinity 정제 방식으로 제조되었습니다. 인간에 반응하며, 마우스 및 랫과 높은 서열 유사성을 가집니다.
- 카탈로그번호
- HPA065279-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA065279-100 Anti-PRKCQ Antibody, protein kinase C, theta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065279-25 Anti-PRKCQ Antibody, protein kinase C, theta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PRKCQ Antibody
Anti-PRKCQ Antibody
Target Information
- Target Protein: protein kinase C, theta
- Target Gene: PRKCQ
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQK
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000026778): 96%
- Rat (ENSRNOG00000019057): 96%
Product Description
Polyclonal antibody against human PRKCQ.
Recommended for protein kinase C, theta detection and related research applications.
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



