CacheBy
Atlas Antibodies Anti-PRKCQ Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRKCQ Antibody

상품 한눈에 보기

인간 PRKCQ 단백질을 인식하는 토끼 유래 폴리클로날 항체입니다. PRKCQ (protein kinase C, theta) 검출용으로 개발되었으며, 고순도의 Affinity 정제 방식으로 제조되었습니다. 인간에 반응하며, 마우스 및 랫과 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA065279-100 Anti-PRKCQ Antibody, protein kinase C, theta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065279-25 Anti-PRKCQ Antibody, protein kinase C, theta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRKCQ Antibody

Anti-PRKCQ Antibody

Target Information

  • Target Protein: protein kinase C, theta
  • Target Gene: PRKCQ
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    SPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQK

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000026778): 96%
  • Rat (ENSRNOG00000019057): 96%

Product Description

Polyclonal antibody against human PRKCQ.
Recommended for protein kinase C, theta detection and related research applications.

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

Additional Resources

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.