
Atlas Antibodies Anti-PRKCQ Antibody
상품 한눈에 보기
인간 PRKCQ 단백질을 인식하는 토끼 유래 폴리클로날 항체입니다. PRKCQ (protein kinase C, theta) 검출용으로 개발되었으며, 고순도의 Affinity 정제 방식으로 제조되었습니다. 인간에 반응하며, 마우스 및 랫과 높은 서열 유사성을 가집니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PRKCQ Antibody
Target Information
- Target Protein: protein kinase C, theta
- Target Gene: PRKCQ
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQK
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000026778): 96%
- Rat (ENSRNOG00000019057): 96%
Product Description
Polyclonal antibody against human PRKCQ.
Recommended for protein kinase C, theta detection and related research applications.
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PRKCI Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRKCH Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRKCQ Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRKCI Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRKCG Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.