
Atlas Antibodies Anti-PRKCG Antibody
상품 한눈에 보기
Human PRKCG 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 등 다양한 응용에 적합. PrEST 항원으로 정제된 고품질 항체. 인간, 마우스, 랫트에서 높은 교차 반응성 확인.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PRKCG Antibody
Target Information
- Target Protein: Protein kinase C, gamma
- Target Gene: PRKCG
- Alternative Gene Names: MGC57564, PKCC, PKCG, SCA14
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal Antibody against Human PRKCG
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
GEYYNVPVADADNCSLLQKFEACNYPLELYERVRMGPSSSPIP
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse: ENSMUSG00000097449 (100%)
- Rat: ENSRNOG00000054371 (100%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PRKCI Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRKCG Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRKCG Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRKCE Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PRKCE Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.