
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PPP4R3B Antibody
상품 한눈에 보기
인간 PPP4R3B 단백질에 특이적인 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간, 마우스, 랫트에서 반응성이 검증되었습니다.
- 카탈로그번호
- HPA001233-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA001233-100 Anti-PPP4R3B Antibody, protein phosphatase 4, regulatory subunit 3B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001233-25 Anti-PPP4R3B Antibody, protein phosphatase 4, regulatory subunit 3B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PPP4R3B Antibody
Anti-PPP4R3B Antibody
Target: protein phosphatase 4, regulatory subunit 3B
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation using RNA-seq data comparison)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human PPP4R3B.
Alternative Gene Names
FLFL2, FLJ31474, KIAA1387, PSY2, SMEK2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protein phosphatase 4, regulatory subunit 3B |
| Target Gene | PPP4R3B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVMPPLE |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000020463 (91%)
- Rat ENSRNOG00000003712 (89%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



