
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PPP4R1 Antibody
상품 한눈에 보기
Human PPP4R1 단백질에 대한 폴리클로날 항체로, IHC, WB, ICC 실험에 적합합니다. siRNA knockdown을 통한 유전적 검증 완료. Rabbit IgG 호스트에서 생성되었으며 PrEST 항원으로 친화 정제되었습니다. PBS/glycerol buffer에 보존제로 sodium azide 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA040905-100 Anti-PPP4R1 Antibody, protein phosphatase 4, regulatory subunit 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040905-25 Anti-PPP4R1 Antibody, protein phosphatase 4, regulatory subunit 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PPP4R1 Antibody
Anti-PPP4R1 Antibody
Target: protein phosphatase 4, regulatory subunit 1
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – Genetic validation by siRNA knockdown
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human PPP4R1.
Alternative Gene Names
- PP4R1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protein phosphatase 4, regulatory subunit 1 |
| Target Gene | PPP4R1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PLDSSLLCTLSSESHQEAASNENDKKPGNYKSMLRPEVGTTSQDSALLDQELYNSFHFWRTPLPEIDLDIELEQNSG |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (67%), Mouse (66%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



