
Atlas Antibodies Anti-PPP4R1 Antibody
상품 한눈에 보기
Human PPP4R1 단백질에 대한 폴리클로날 항체로, IHC, WB, ICC 실험에 적합합니다. siRNA knockdown을 통한 유전적 검증 완료. Rabbit IgG 호스트에서 생성되었으며 PrEST 항원으로 친화 정제되었습니다. PBS/glycerol buffer에 보존제로 sodium azide 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PPP4R1 Antibody
Target: protein phosphatase 4, regulatory subunit 1
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – Genetic validation by siRNA knockdown
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human PPP4R1.
Alternative Gene Names
- PP4R1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protein phosphatase 4, regulatory subunit 1 |
| Target Gene | PPP4R1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PLDSSLLCTLSSESHQEAASNENDKKPGNYKSMLRPEVGTTSQDSALLDQELYNSFHFWRTPLPEIDLDIELEQNSG |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (67%), Mouse (66%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PPP4R1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP4R2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP4R1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP4R2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP4C Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.