Atlas Antibodies Anti-PPP1R1B Antibody
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA048630-100 | - | Atlas Antibodies HPA048630-100 Anti-PPP1R1B Antibody, protein phosphatase 1, regulatory (inhibitor) subunit 1B 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | ||
HPA048630-25 | - | Atlas Antibodies HPA048630-25 Anti-PPP1R1B Antibody, protein phosphatase 1, regulatory (inhibitor) subunit 1B 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 |
다른 상품 둘러보기
Anti-PPP1R1B Antibody
protein phosphatase 1, regulatory (inhibitor) subunit 1B
Recommended Applications
Product Description
Polyclonal Antibody against Human PPP1R1B
Alternative Gene Names
DARPP-32, FLJ20940
Target Protein
protein phosphatase 1, regulatory (inhibitor) subunit 1B
Target Gene
PPP1R1B
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
PTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDE
Verified Species Reactivity
Human, Mouse
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000028404 (91%)
Mouse ENSMUSG00000061718 (87%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|