
Atlas Antibodies Anti-PPP1R12A Antibody
상품 한눈에 보기
Human PPP1R12A 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. ICC 등 다양한 응용에 적합하며, 40% 글리세롤 및 PBS 완충액에 보존. Human에 대해 검증된 반응성을 가짐.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PPP1R12A Antibody
Protein phosphatase 1, regulatory subunit 12A
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human PPP1R12A.
Alternative Gene Names
M130, MBS, MYPT1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Protein phosphatase 1, regulatory subunit 12A |
| Target Gene | PPP1R12A |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse (87%), Rat (86%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
GVSFWTQDSDENEQEQQSDTEEGSNKKETQTDSISRYETSSTSAGDRYDSLLGRSGSYSYLEERKPYSSRLEKDDSTDFKKLYEQILAENEELK
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PPP1R13L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP1R12B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP1R12A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP1R12A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PPP1R11 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.