
Thermo Fisher Scientific hb Polyclonal Antibody
상품 한눈에 보기
Fruit fly hb 단백질을 인식하는 Thermo Fisher Scientific의 rabbit polyclonal antibody. Western blot에 적합하며, 고순도 affinity chromatography로 정제됨. 액상 형태로 제공되며 -20°C에서 장기 보관 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific hb Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution: 0.2–1.0 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Fruit fly |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a region of fruit fly hb |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5–1.0 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2689369 |
Product Specific Information
- This target displays homology in the following species: Rat: 100%
- Peptide sequence: MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIP
- For short term use, store at 2–8°C up to 1 week.
- For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
- Concentration is batch dependent: 0.5–1 mg/mL.
Target Information
Gap class segmentation protein that controls development of head structures.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific exd Polyclonal Antibody
642,300원

Thermo Fisher Scientific
Thermo Fisher Scientific lab Polyclonal Antibody
642,300원

Thermo Fisher Scientific
Thermo Fisher Scientific hb Polyclonal Antibody
726,800원

Thermo Fisher Scientific
Thermo Fisher Scientific CAD Polyclonal Antibody
642,300원

Thermo Fisher Scientific
Thermo Fisher Scientific Nectin 2 Polyclonal Antibody
642,300원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.