원본
Thermo Fisher Scientific hb Polyclonal Antibody
상품 한눈에 보기
Fruit fly hb 단백질을 인식하는 Thermo Fisher Scientific의 rabbit polyclonal antibody. Western blot에 적합하며, 고순도 affinity chromatography로 정제됨. 액상 형태로 제공되며 -20°C에서 장기 보관 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 03:24
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA569509 hb Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
726,800원VAT 포함 799,480원
Thermo Fisher Scientific · Thermo Fisher Scientific hb Polyclonal Antibody
Thermo Fisher Scientific hb Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution: 0.2–1.0 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Fruit fly |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a region of fruit fly hb |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5–1.0 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2689369 |
Product Specific Information
- This target displays homology in the following species: Rat: 100%
- Peptide sequence: MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIP
- For short term use, store at 2–8°C up to 1 week.
- For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
- Concentration is batch dependent: 0.5–1 mg/mL.
Target Information
Gap class segmentation protein that controls development of head structures.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific exd Polyclonal Antibody642,300원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific lab Polyclonal Antibody642,300원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific CAD Polyclonal Antibody642,300원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Nectin 2 Polyclonal Antibody642,300원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.