원본
Thermo Fisher Scientific SLC12A1 Polyclonal Antibody
상품 한눈에 보기
SLC12A1 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, Western blot 및 IHC(P) 실험에 적합합니다. 인간, 마우스, 원숭이, 랫트 반응성이 있으며, 동결건조 형태로 제공되어 안정적인 보관이 가능합니다.
- 카탈로그번호
- PA580003
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오전 06:17
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA580003 SLC12A1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific SLC12A1 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.25–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 2–5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Non-human primate, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human SLC12A1 (52–83aa DEAQKRLRISFRPGNQECYDNFLQSGETAKTD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747118 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The sodium-potassium-chloride cotransporter isoform 2 (NKCC2) is kidney-specific and located on the apical membrane of the thick ascending limb of Henle’s loop and the macula densa. It mediates NaCl resorption with a stoichiometry of 1Na:1K:2Cl and is sensitive to diuretics such as furosemide and bumetanide. Mutations in this gene are associated with Bartter-like syndromes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific SLC12A6 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SLC12A3 Polyclonal Antibody514,100원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SLC12A1 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SHC Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.