Thermo Fisher Scientific SLC12A1 Polyclonal Antibody
SLC12A1 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, Western blot 및 IHC(P) 실험에 적합합니다. 인간, 마우스, 원숭이, 랫트 반응성이 있으며, 동결건조 형태로 제공되어 안정적인 보관이 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.25–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 2–5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Non-human primate, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human SLC12A1 (52–83aa DEAQKRLRISFRPGNQECYDNFLQSGETAKTD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747118 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The sodium-potassium-chloride cotransporter isoform 2 (NKCC2) is kidney-specific and located on the apical membrane of the thick ascending limb of Henle’s loop and the macula densa. It mediates NaCl resorption with a stoichiometry of 1Na:1K:2Cl and is sensitive to diuretics such as furosemide and bumetanide. Mutations in this gene are associated with Bartter-like syndromes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific SLC12A6 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SLC12A3 Polyclonal Antibody
514,100원
Thermo Fisher Scientific
Thermo Fisher Scientific SLC12A1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SLC12A1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SHC Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|