
Atlas Antibodies Anti-CLEC3B Antibody
상품 한눈에 보기
인간 CLEC3B 단백질을 인식하는 폴리클로날 항체로 면역조직화학(IHC) 및 웨스턴블롯(WB)에 적합합니다. 토끼에서 생산된 IgG 형 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인체 반응성이 검증된 고품질 연구용 시약입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CLEC3B Antibody
C-type lectin domain family 3, member B
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human CLEC3B.
Alternative Gene Names
- TN
- TNA
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | C-type lectin domain family 3, member B |
| Target Gene | CLEC3B |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat (83%), Mouse (82%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
TGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIBuffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CLEC4C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CLEC4D Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CLEC3B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CLEC4F Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CLEC4M Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.