
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CHMP6 Antibody
상품 한눈에 보기
Human CHMP6 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB(재조합 발현 검증)에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성(95%)을 보입니다. 40% glycerol/PBS buffer로 안정화되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA024460-100 Anti-CHMP6 Antibody, charged multivesicular body protein 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024460-25 Anti-CHMP6 Antibody, charged multivesicular body protein 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CHMP6 Antibody
Anti-CHMP6 Antibody
Target Protein: charged multivesicular body protein 6 (CHMP6)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human CHMP6.
Alternative Gene Names
FLJ11749, VPS20
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | charged multivesicular body protein 6 |
| Target Gene | CHMP6 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | MGNLFGCKKQSRVTEQDKAILQLKQQRDKLRQYQKRIAQQLERERALARQLLRDGRKERAKLLLKKKRYQEQLLDRTENQISSLEAMVQSIEFTQIEMKV |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000004014 (95%)
- Mouse ENSMUSG00000025371 (95%)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



