CacheBy
Atlas Antibodies Anti-CHMP6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CHMP6 Antibody

상품 한눈에 보기

Human CHMP6 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB(재조합 발현 검증)에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성(95%)을 보입니다. 40% glycerol/PBS buffer로 안정화되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024460-100 Anti-CHMP6 Antibody, charged multivesicular body protein 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024460-25 Anti-CHMP6 Antibody, charged multivesicular body protein 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CHMP6 Antibody

Anti-CHMP6 Antibody

Target Protein: charged multivesicular body protein 6 (CHMP6)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Recombinant Expression Validation)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal antibody against human CHMP6.


Alternative Gene Names

FLJ11749, VPS20

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein charged multivesicular body protein 6
Target Gene CHMP6
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence MGNLFGCKKQSRVTEQDKAILQLKQQRDKLRQYQKRIAQQLERERALARQLLRDGRKERAKLLLKKKRYQEQLLDRTENQISSLEAMVQSIEFTQIEMKV

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000004014 (95%)
  • Mouse ENSMUSG00000025371 (95%)

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Tooltip Recombinant Expression

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.