CacheBy
Atlas Antibodies Anti-CHMP5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CHMP5 Antibody

상품 한눈에 보기

인간 CHMP5 단백질을 인식하는 폴리클로날 항체로, 독립 항체 비교를 통한 IHC 검증 완료. 토끼 유래 IgG 항체이며 PrEST 항원으로 친화 정제됨. 인간, 마우스, 랫트에 높은 반응성(99% 동일성). 40% 글리세롤 PBS 버퍼에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042883-100 Anti-CHMP5 Antibody, charged multivesicular body protein 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042883-25 Anti-CHMP5 Antibody, charged multivesicular body protein 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CHMP5 Antibody

Anti-CHMP5 Antibody

Target: charged multivesicular body protein 5


Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human CHMP5


Alternative Gene Names

C9orf83, CGI-34, HSPC177, SNF7DC2, Vps60

Open Datasheet


Target Information

항목 내용
Target Protein charged multivesicular body protein 5
Target Gene CHMP5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (99%), Rat (99%)

Antigen Sequence:

NRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRV

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.